Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Egyptian Mahshi: Stuffed Vegetables

Hollowed zucchini and tomatoes stuffed with spiced rice and herbs, then simmered in tomato sauce. A vegetarian Egyptian classic that's hearty, fragrant, and deeply satisfying.

Total time
55 min
Servings
4
Calories
285
Protein
7g
Egyptian Mahshi: Stuffed Vegetables
comfortwholesomeegyptianmediterraneanvegetarianvegetariantenderfluffy

Ingredients

9 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Trim zucchini ends. Using a vegetable corer or thin knife, hollow out centers, leaving 1/4-inch shell. Reserve scooped flesh.

  2. Step 2

    Cut off zucchini-sized tops from tomatoes. Scoop out insides with a spoon, leaving thin shells. Reserve pulp.

  3. Step 3

    Chop reserved zucchini flesh and tomato pulp into small pieces.

  4. Step 4

    Heat 2 tbsp oil in a large pot over medium-high. Add diced onion, cook 4 minutes until soft and translucent.

  5. Step 5

    Add rice, stir 2 minutes until lightly toasted and fragrant.

  6. Step 6

    Stir in reserved zucchini and tomato pieces, parsley, dill, salt, and pepper. Cook 2 minutes, then remove from heat.

  7. Step 7

    Spoon rice mixture evenly into hollowed zucchini and tomato shells. Stand them upright in the same pot.

  8. Step 8

    Pour crushed tomatoes around the vegetables. Drizzle with remaining 2 tbsp oil, add 1 cup water.

  9. Step 9

    Bring to a boil over medium-high heat, then reduce to medium-low, cover, and simmer 35 minutes until rice is tender.

  10. Step 10

    Serve hot with sauce spooned over and around the vegetables.

Tools you’ll need

  • vegetable corer or thin sharp knife
  • large pot with lid (12-inch or larger)
  • spoon or small ice-cream scoop
  • cutting board
  • chef's knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.