Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Empanadas Colombianas con Ají

Crispy fried pastries filled with seasoned ground beef and potatoes, served with a vibrant cilantro-jalapeño sauce. A beloved Colombian comfort food ready in under an hour.

Total time
55 min
Servings
4
Calories
420
Protein
12g
Empanadas Colombianas con Ají
comfortcasualcolombianbeefcrispytenderweeknightdinner

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat 1 tbsp oil in a large skillet over medium-high until shimmering.

  2. Step 2

    Add diced potato and cook without stirring, 2 minutes per side, until light golden.

  3. Step 3

    Push potatoes to the side. Add ground beef, break apart with a spoon, cook until no pink remains, ~5 minutes.

  4. Step 4

    Add diced onion, stir, and cook until soft and fragrant, 2 minutes.

  5. Step 5

    Season with salt and pepper. Remove from heat and let cool 5 minutes.

  6. Step 6

    Place 1.5 tbsp filling slightly off-center on each empanada wrapper.

  7. Step 7

    Fold wrapper in half and press edges firmly to seal. Crimp with a fork if desired.

  8. Step 8

    Heat 3 cups oil in a deep pot to 350°F. Fry empanadas in batches, 3 minutes per side, until deep golden.

  9. Step 9

    Transfer to a paper-towel-lined plate.

  10. Step 10

    Mix cilantro and jalapeño with 2 tbsp water and pinch of salt for ají sauce.

  11. Step 11

    Serve empanadas hot with ají sauce on the side.

Tools you’ll need

  • large skillet
  • deep pot (at least 4 quarts)
  • cooking thermometer
  • wooden spoon
  • fork (for crimping)
  • paper towels
  • slotted spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.