Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

10-Minute English Muffin Pizzas

Split English muffins, top with pizza sauce and melted mozzarella, then broil until bubbly and golden. A cheesy, crispy-edged snack or quick lunch that's ready in minutes.

Total time
10 min
Servings
2
Calories
320
Protein
14g
10-Minute English Muffin Pizzas
quickcasualamericanvegetariancheesecrispymeltyweeknight

Ingredients

3 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Split the English muffins in half and place them cut-side up on a baking sheet.

  2. Step 2

    Spread about 2 tablespoons of pizza sauce on each muffin half.

  3. Step 3

    Divide the mozzarella evenly among the four muffin halves, covering the sauce.

  4. Step 4

    Broil 4 inches from the heat for 2–3 minutes until cheese melts and edges brown.

  5. Step 5

    Serve hot straight from the oven.

Tools you’ll need

  • baking sheet
  • broiler

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.