Back to recipes
10-Min Cheesy Pita Pizza
Crispy pita bread topped with pizza sauce, melted mozzarella, and mushrooms — ready in minutes. Perfect weeknight snack or quick lunch.
- Total time
- 10 min
- Servings
- 2
- Calories
- 285
- Protein
- 14g
quickcasualamericanvegetariancrispymeltyweeknightsnack
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Place pita rounds on a baking sheet and spread pizza sauce evenly across each.
Step 2
Scatter mushroom slices over the sauce, then top with shredded mozzarella.
Step 3
Broil 4 inches from heat for 3–4 minutes until cheese melts and edges crisp.
Step 4
Remove and let cool 1 minute before serving.
Tools you’ll need
- baking sheet
- oven broiler
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
