Back to recipes
10-Minute Pita Pizzas
Crispy pita bread topped with pizza sauce and melted mozzarella — ready in the time it takes to preheat your oven. Perfect for a quick lunch, snack, or easy dinner.
- Total time
- 10 min
- Servings
- 2
- Calories
- 310
- Protein
- 14g
quickcasualamericanvegetariancrispymeltyweeknightpizza
Ingredients
3 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Heat oven to 400°F.
Step 2
Place pita bread on a baking sheet and spread 1/4 cup pizza sauce on each.
Step 3
Top each pita with 1/2 cup shredded mozzarella, spreading it to the edges.
Step 4
Bake until cheese is melted and edges of pita are golden, about 6 minutes.
Step 5
Slide onto a plate and serve hot.
Tools you’ll need
- oven
- baking sheet
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
