10-Minute Pita Pizzas
Crispy pita bread topped with pizza sauce and melted mozzarella — ready in the time it takes to preheat your oven. Perfect for a quick lunch, snack, or easy dinner.
- Total time
- 10 min
- Servings
- 2
- Calories
- 310
- Protein
- 14g

quickcasualamericanvegetariancrispymeltyweeknightpizza
Ingredients
- 2 pieces pita bread
- ½ cup pizza sauce
- 1 cup mozzarella cheese, shredded
Instructions
- 1
Heat oven to 400°F.
- 2
Place pita bread on a baking sheet and spread 1/4 cup pizza sauce on each.
- 3
Top each pita with 1/2 cup shredded mozzarella, spreading it to the edges.
- 4
Bake until cheese is melted and edges of pita are golden, about 6 minutes.
- 5
Slide onto a plate and serve hot.
Tools you’ll need
- oven
- baking sheet
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



