Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Fattet Hummus

Creamy hummus layered with crispy pita chips, toasted chickpeas, and drizzled with garlic oil. A Lebanese breakfast classic that's warm, textured, and deeply satisfying.

Total time
12 min
Servings
4
Calories
420
Protein
12g
Fattet Hummus
wholesomecomfortinglebanesevegetarianveganchickpeascrispycreamy

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut pita into triangles. Arrange on a sheet pan and toast in a 400°F oven until golden and crispy, 6–8 minutes.

  2. Step 2

    Spread hummus in a shallow bowl, creating a slight well in the center with the back of a spoon.

  3. Step 3

    Heat olive oil in a small pan over medium. Add minced garlic and cook until fragrant and golden, ~1 minute. Do not brown.

  4. Step 4

    Add drained chickpeas to the oil and toss for 2 minutes until warmed through and lightly golden.

  5. Step 5

    Pour the warm garlic oil and chickpeas over the hummus. Top with crispy pita chips and serve immediately.

Tools you’ll need

  • sheet pan
  • shallow serving bowl
  • small pan (8-inch)
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.