Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Fattet Hummus

Creamy hummus topped with crispy pita chips, warm spiced chickpeas, and a drizzle of olive oil infused with garlic and sumac. A showstopping Lebanese breakfast that's ready in under 15 minutes.

Total time
12 min
Servings
4
Calories
485
Protein
12g
Fattet Hummus
elegantfreshlebanesevegetarianveganchickpeascreamycrispy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pulse chickpeas, tahini, garlic, and lemon juice in a food processor until mostly smooth.

  2. Step 2

    With motor running, drizzle in 0.25 cup olive oil until hummus is light and creamy.

  3. Step 3

    Season with salt and pepper to taste. Transfer to a shallow bowl.

  4. Step 4

    Cut pita into triangles. Heat remaining 0.25 cup olive oil in a skillet over medium-high.

  5. Step 5

    Fry pita triangles in batches until golden and crispy, about 2 minutes per batch.

  6. Step 6

    Arrange hot pita chips over hummus. Drizzle with the pan's garlic-infused oil.

  7. Step 7

    Sprinkle sumac over the top and serve immediately while pita is still warm.

Tools you’ll need

  • food processor
  • 12-inch skillet
  • shallow serving bowl
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.