Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Filipino Mami

A silky egg noodle soup loaded with tender chicken, shrimp, and vegetables in a savory broth. Ready in under 30 minutes with minimal prep.

Total time
25 min
Servings
2
Calories
340
Protein
38g
Filipino Mami
comfortcozyfilipinochickenshrimptendersilkyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Place the chicken breast on a cutting board and slice it lengthwise (from one long edge to the other) into thin strips about 1/4 inch thick, like cutting a sandwich roll. This helps it cook faster in the broth.

  2. Step 2

    Place the carrot on a cutting board and slice it diagonally into thin ovals about 1/8 inch thick, angling the knife to create long, flat pieces.

  3. Step 3

    Cut the onion in half from root to tip, place the flat side down, and slice lengthwise from root to tip into half-moon pieces about 1/4 inch wide.

  4. Step 4

    Pour the broth into a large pot and set heat to high until the surface looks active with small rolling bubbles, about 3 to 4 minutes.

  5. Step 5

    Add the sliced chicken to the boiling broth and stir once to separate the pieces, then reduce heat to medium-low and simmer uncovered for 5 minutes until the chicken turns opaque white throughout.

  6. Step 6

    Add the shrimp to the pot and stir gently once to combine, then simmer for 2 minutes until the shrimp turn pink and curl into a C shape.

  7. Step 7

    Add the carrot slices and onion pieces to the broth and stir once, then simmer for 2 minutes until the vegetables soften slightly.

  8. Step 8

    Add the fresh egg noodles to the pot, stirring gently to separate them from each other, and simmer for 3 to 4 minutes until the noodles are soft and tender.

  9. Step 9

    Taste the broth by taking a small spoonful and tasting it, then season with salt and pepper to taste.

  10. Step 10

    Ladle the soup into two bowls, ensuring each gets an equal share of noodles, chicken, shrimp, and vegetables, then serve immediately while steaming.

Tools you’ll need

  • cutting board
  • chef's knife
  • large pot (at least 3-quart capacity)
  • wooden spoon or silicone spatula
  • ladle
  • bowls
  • tongs (optional, for moving noodles)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.