Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

25-Min Fish Sinigang with Crispy Fried Shallots

Tangy tamarind broth loaded with tender fish and vegetables, finished with crispy fried shallots for texture. Serve with fried spring rolls and a spicy vinegar dip for dipping.

Total time
25 min
Servings
2
Calories
285
Protein
28g
25-Min Fish Sinigang with Crispy Fried Shallots
comfortheartyfilipinofishtendercrispyweeknightdinner

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large pot over medium-high. Fry 1/2 cup sliced shallots until golden and crispy, 3–4 minutes. Transfer to a paper towel; set aside.

  2. Step 2

    In the same pot, bring stock and remaining shallots to a boil over high heat, 2 minutes.

  3. Step 3

    Stir tamarind paste into the broth until dissolved. Add radish slices and bring to a gentle simmer.

  4. Step 4

    Slide fish chunks into the broth. Cook at a gentle bubble until fish is opaque and flakes easily, 6–7 minutes.

  5. Step 5

    Stir in leafy greens and cook until just wilted, 1 minute. Taste and adjust salt and tamarind as needed.

  6. Step 6

    Pour into bowls, top with crispy fried shallots, and serve with fried spring rolls and spicy vinegar dip on the side.

Tools you’ll need

  • large heavy-bottomed pot (4–6 quart capacity)
  • slotted spoon
  • paper towels
  • spoon for stirring
  • bowls for serving

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.