CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Fluffy Buttermilk Waffles

Crispy-outside, fluffy-inside waffles ready in under 20 minutes. Mix the batter, heat the iron, and flip straight onto a plate.

Total time
18 min
Servings
4
Calories
380
Protein
8g
Fluffy Buttermilk Waffles
comfortsimpleamericanvegetarianeggscrispyfluffyBreakfast

Ingredients

  • 2 cups all-purpose flour
  • 2 large eggs
  • 1.75 cups buttermilk
  • 4 tbsp butter, melted
  • 2 tbsp granulated sugar
  • 2 tsp baking powder

Instructions

  1. 1

    Heat your waffle iron on high heat until a drop of water sizzles and evaporates on contact, ~3 minutes.

  2. 2

    Whisk flour, baking powder, sugar, and a pinch of salt in a large bowl.

  3. 3

    Crack eggs into a second bowl, pour in buttermilk and melted butter, and whisk until combined.

  4. 4

    Pour wet into dry and fold gently with a spatula until just combined—lumps are okay, overworking makes dense waffles.

  5. 5

    Brush the waffle iron with a little butter, pour batter to the top, close, and cook until steam stops and the lid lifts easily, ~3 minutes.

  6. 6

    Slide the waffle onto a plate. Repeat with remaining batter. Serve hot with toppings of your choice.

Tools you’ll need

  • waffle iron
  • large mixing bowl
  • medium mixing bowl
  • whisk
  • spatula
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.