Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Fluffy Buttermilk Waffles

Crispy-outside, fluffy-inside waffles ready in under 20 minutes. Mix the batter, heat the iron, and flip straight onto a plate.

Total time
18 min
Servings
4
Calories
380
Protein
8g
Fluffy Buttermilk Waffles
comfortsimpleamericanvegetarianeggscrispyfluffyBreakfast

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat your waffle iron on high heat until a drop of water sizzles and evaporates on contact, ~3 minutes.

  2. Step 2

    Whisk flour, baking powder, sugar, and a pinch of salt in a large bowl.

  3. Step 3

    Crack eggs into a second bowl, pour in buttermilk and melted butter, and whisk until combined.

  4. Step 4

    Pour wet into dry and fold gently with a spatula until just combined—lumps are okay, overworking makes dense waffles.

  5. Step 5

    Brush the waffle iron with a little butter, pour batter to the top, close, and cook until steam stops and the lid lifts easily, ~3 minutes.

  6. Step 6

    Slide the waffle onto a plate. Repeat with remaining batter. Serve hot with toppings of your choice.

Tools you’ll need

  • waffle iron
  • large mixing bowl
  • medium mixing bowl
  • whisk
  • spatula
  • pastry brush

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.