Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Homemade Waffles

Fluffy on the inside, golden-brown and crispy on the outside—these waffles come together in under 20 minutes with zero fussy steps. Perfect for breakfast, brunch, or a sweet dinner.

Total time
18 min
Servings
4
Calories
312
Protein
8g
Crispy Homemade Waffles
comfortsimpleamericanvegetariancrispyfluffyBreakfastbrunch

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk flour, sugar, baking powder, and salt in a large bowl until combined.

  2. Step 2

    In another bowl, whisk eggs and milk together, then stir in melted butter.

  3. Step 3

    Pour wet ingredients into dry ingredients. Stir gently until just combined—lumps are fine, don't overmix.

  4. Step 4

    Preheat waffle iron for 2 minutes until it stops steaming and the ready light comes on.

  5. Step 5

    Lightly grease the iron, then pour 0.75 cup batter in and close. Cook until golden brown and steam stops, ~3 minutes.

  6. Step 6

    Transfer to a plate and repeat with remaining batter. Serve warm with your choice of toppings.

Tools you’ll need

  • waffle iron
  • large mixing bowl
  • medium mixing bowl
  • whisk
  • measuring cups and spoons
  • spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.