Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Fondue Moitié-Moitié

A classic Swiss cheese fondue combining Emmental and Gruyère for a silky, nutty dip. Serve with crusty bread cubes, potatoes, and vegetables for an interactive dinner.

Total time
20 min
Servings
4
Calories
420
Protein
24g
Fondue Moitié-Moitié
comfortindulgentswissvegetariancheesecreamysilkymelty

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix grated Emmental and Gruyère in a bowl. Toss with cornstarch until each piece is coated.

  2. Step 2

    Cut bread into 1-inch cubes. Boil potatoes until fork-tender; halve them. Arrange all dipping items on a platter.

  3. Step 3

    Rub the inside of a fondue pot or small heavy saucepan with the halved garlic; discard garlic.

  4. Step 4

    Pour wine into the pot and warm over medium heat until wisps of steam appear, ~3 minutes.

  5. Step 5

    Add cheese handful by handful, stirring constantly in a figure-8 pattern until melted and smooth, ~6 minutes.

  6. Step 6

    Season with black pepper. The fondue should coat the back of a spoon; if too thick, stir in 1–2 tbsp wine.

  7. Step 7

    Transfer to a fondue pot over a low flame, or keep in the saucepan on a trivet over a lit candle or burner.

  8. Step 8

    Serve immediately. Spear bread or vegetables, dip, swirl in the pot, and eat.

Tools you’ll need

  • fondue pot or small heavy-bottomed saucepan
  • fondue forks or long skewers
  • wooden spoon
  • grater
  • cutting board
  • kitchen knife
  • medium bowl
  • whisk or spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.