CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Fondue Savoyarde

Alpine cheese fondue with Emmental, Beaufort, and Reblochon melted into a silky, wine-spiked dip. Serve with crusty bread, potatoes, and pickled onions for a cozy French dinner.

Total time
25 min
Servings
4
Calories
485
Protein
28g
Fondue Savoyarde
comfortcozyfrenchvegetariancheesecreamymeltysilky

Ingredients

  • 6 oz Emmental cheese, coarsely grated
  • 6 oz Beaufort or Gruyère cheese, coarsely grated
  • 4 oz Reblochon cheese, cut into small chunks
  • 1 cup dry white wine (Savoie or unoaked Chardonnay)
  • 1 tbsp fresh lemon juice
  • 1 tbsp cornstarch
  • 1 whole garlic clove, halved
  • ⅛ tsp nutmeg, salt, and black pepper to taste

Instructions

  1. 1

    Toss grated Emmental and Beaufort with cornstarch in a bowl until evenly coated.

  2. 2

    Rub the inside of a fondue pot or heavy saucepan with the halved garlic clove.

  3. 3

    Pour wine and lemon juice into the pot. Heat over medium until small bubbles rise, ~3 minutes.

  4. 4

    Add cornstarch-coated cheeses one handful at a time, stirring constantly until melted.

  5. 5

    Add Reblochon chunks and keep stirring until the mixture is smooth and creamy, ~2 minutes.

  6. 6

    Season with a pinch of nutmeg, salt, and black pepper to taste.

  7. 7

    Transfer to a fondue pot with a heat source or keep in a slow cooker set to warm.

  8. 8

    Serve with crusty bread cubes, boiled potatoes, pickled onions, and cured meats for dipping.

Tools you’ll need

  • fondue pot or heavy-bottomed saucepan
  • fondue forks or wooden skewers
  • whisk
  • grater
  • heat source (fondue burner, slow cooker, or kitchen torch)

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.