Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Fondue Savoyarde

Alpine cheese fondue with Emmental, Beaufort, and Reblochon melted into a silky, wine-spiked dip. Serve with crusty bread, potatoes, and pickled onions for a cozy French dinner.

Total time
25 min
Servings
4
Calories
485
Protein
28g
Fondue Savoyarde
comfortcozyfrenchvegetariancheesecreamymeltysilky

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Toss grated Emmental and Beaufort with cornstarch in a bowl until evenly coated.

  2. Step 2

    Rub the inside of a fondue pot or heavy saucepan with the halved garlic clove.

  3. Step 3

    Pour wine and lemon juice into the pot. Heat over medium until small bubbles rise, ~3 minutes.

  4. Step 4

    Add cornstarch-coated cheeses one handful at a time, stirring constantly until melted.

  5. Step 5

    Add Reblochon chunks and keep stirring until the mixture is smooth and creamy, ~2 minutes.

  6. Step 6

    Season with a pinch of nutmeg, salt, and black pepper to taste.

  7. Step 7

    Transfer to a fondue pot with a heat source or keep in a slow cooker set to warm.

  8. Step 8

    Serve with crusty bread cubes, boiled potatoes, pickled onions, and cured meats for dipping.

Tools you’ll need

  • fondue pot or heavy-bottomed saucepan
  • fondue forks or wooden skewers
  • whisk
  • grater
  • heat source (fondue burner, slow cooker, or kitchen torch)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.