Custrd is out on the App Store — Download it free →
Back to recipes

Fried Catfish with French Fries

Crispy golden catfish fillets served with hot french fries and a squeeze of fresh lemon. A quick, satisfying meal that's ready in about 20 minutes.

Total time
25 min
Servings
4
Calories
520
Protein
28g
Fried Catfish with French Fries
comfort foodweeknightamericanfishcrispyflakycasual dinnermain course

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Spread the 1 bag frozen french fries on a baking sheet and bake until golden and crispy, about 15-20 minutes, shaking halfway.

  2. Step 2

    While fries bake, pat dry 4 catfish fillets. In a shallow dish, mix 1/2 cup flour, 1/2 cup cornmeal, 1 tsp salt, and 1/2 tsp black pepper.

  3. Step 3

    Beat 1 egg in a shallow bowl. Dip each fillet in the egg, then coat with the flour mixture, pressing gently to adhere.

  4. Step 4

    Heat 1/4 cup vegetable oil in a large skillet over medium-high heat. Fry the fillets in batches, not crowding the pan, until golden brown and cooked through, about 3-4 minutes per side.

  5. Step 5

    Serve the fried catfish with the hot fries and lemon wedges for squeezing over the fish.

Tools you’ll need

  • baking sheet
  • large skillet
  • shallow dishes
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.