Custrd is out on the App Store — Download it free →
Back to recipes

Fried Shrimp with Dipping Sauce

Crispy golden fried shrimp served with a tangy, savory dipping sauce, fresh lime wedges, and crunchy red bell pepper strips. A quick and satisfying weeknight dinner.

Total time
35 min
Servings
4
Calories
480
Protein
28g
Fried Shrimp with Dipping Sauce
comfort foodweeknightamericanshrimpcrispyjuicycasual dinnermain course

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the 1 lb shrimp dry with paper towels. Set up three shallow bowls: 1 cup flour, 2 beaten eggs, and 1.5 cups panko breadcrumbs.

  2. Step 2

    Heat 1 cup vegetable oil in a large skillet over medium-high until shimmering, about 2 minutes. Test with a breadcrumb—it should sizzle immediately.

  3. Step 3

    Dredge each shrimp in flour, then egg, then panko, pressing gently to coat. Work in batches to avoid crowding the pan.

  4. Step 4

    Fry the shrimp in the hot oil until golden brown and crispy, about 2-3 minutes per side. Transfer to a paper towel-lined plate.

  5. Step 5

    In a small bowl, mix 0.5 cup mayonnaise, 2 tbsp sriracha, and the juice of half the lime. Adjust heat with more sriracha if desired.

  6. Step 6

    Serve the fried shrimp hot with the dipping sauce, lime wedges, and red bell pepper strips on the side.

Tools you’ll need

  • large skillet
  • shallow bowls
  • paper towels
  • small bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.