Custrd is out on the App Store — Download it free →
Back to recipes

Fried Chicken Gizzards with Onions over Mashed Potatoes

Crispy, savory chicken gizzards sautéed with sweet onions, served over creamy mashed potatoes. A quick, comforting weeknight meal.

Total time
25 min
Servings
4
Calories
380
Protein
28g
Fried Chicken Gizzards with Onions over Mashed Potatoes
comfortingamericangluten-freechickencrispycreamyweeknightmain

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil the 1.5 lb potatoes in salted water until fork-tender, about 15 minutes. Drain and return to pot.

  2. Step 2

    Mash potatoes with 2 tbsp butter and 1/4 cup milk until smooth. Season with salt and pepper. Cover and set aside.

  3. Step 3

    While potatoes cook, trim and rinse 1 lb gizzards. Pat dry, then season with salt and pepper.

  4. Step 4

    Heat 2 tbsp oil in a large skillet over medium-high. Add gizzards in a single layer and cook until browned and cooked through, about 8 minutes, turning occasionally.

  5. Step 5

    Add 1 sliced onion to the skillet and cook until soft and golden, about 3 minutes. Serve gizzards and onions over mashed potatoes.

Tools you’ll need

  • large pot
  • skillet
  • masher

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.