Custrd is out on the App Store — Download it free →
Back to recipes

Fried Chicken Strips with French Fries

Crispy golden chicken strips paired with homemade french fries and ketchup for dipping. A classic weeknight dinner that's simple and satisfying.

Total time
40 min
Servings
4
Calories
650
Protein
35g
Fried Chicken Strips with French Fries
comfort foodamericanchickencrispytenderweeknight dinnermain coursedinner

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Cut the 2 lb potatoes into thin sticks and soak in cold water for 10 minutes. Pat dry thoroughly with a clean towel.

  2. Step 2

    Slice the 1.5 lb chicken breast into 1-inch wide strips. Season with 0.5 tsp salt and 0.25 tsp black pepper.

  3. Step 3

    Set up a dredging station: place 1 cup flour in one bowl, and beat 2 eggs in another. Dip each chicken strip into the flour, then the egg, then back into the flour.

  4. Step 4

    Heat 2 cups vegetable oil in a deep skillet over medium-high until a pinch of flour sizzles. Fry the chicken strips in batches, turning occasionally, until golden brown and cooked through, about 6-8 minutes per batch. Drain on paper towels.

  5. Step 5

    In the same oil, fry the potato sticks in batches until golden and crispy, about 5-7 minutes per batch. Remove and drain on paper towels.

  6. Step 6

    Sprinkle the fries with the remaining 0.5 tsp salt and 0.25 tsp black pepper. Serve the chicken strips and fries hot with 0.5 cup ketchup for dipping.

Tools you’ll need

  • deep skillet
  • mixing bowls
  • paper towels
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.