Back to recipes
15-Minute Funfetti Cake Mix Cookies
Dump cake mix, egg, oil, and sprinkles into a bowl, scoop onto a sheet pan, and bake until golden. These taste like birthday cake in cookie form — no mixer, no fuss.
- Total time
- 15 min
- Servings
- 12
- Calories
- 195
- Protein
- 1g
indulgentnostalgicamericansoftchewyweeknightpartykids-party
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Preheat oven to 350°F.
Step 2
Mix cake mix, egg, oil, and sprinkles in a bowl until just combined.
Step 3
Drop spoonfuls onto a parchment-lined sheet pan, spacing 2 inches apart.
Step 4
Bake 10–12 minutes until edges are set but centers still look soft.
Step 5
Cool on the pan 5 minutes, then transfer to a wire rack.
Tools you’ll need
- mixing bowl
- spoon
- sheet pan
- parchment paper
- oven
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.
