Back to recipes
15-Minute Funfetti Cake Mix Cookies
Dump cake mix, egg, oil, and sprinkles into a bowl, scoop onto a sheet pan, and bake until golden. These taste like birthday cake in cookie form — no mixer, no fuss.
- Total time
- 15 min
- Servings
- 12
- Calories
- 195
- Protein
- 1g
indulgentnostalgicamericansoftchewyweeknightpartykids-party
Ingredients
4 items — tap to check off
Missing one? Custrd suggests a swap that works.
Open the appInstructions
Step 1
Preheat oven to 350°F.
Step 2
Mix cake mix, egg, oil, and sprinkles in a bowl until just combined.
Step 3
Drop spoonfuls onto a parchment-lined sheet pan, spacing 2 inches apart.
Step 4
Bake 10–12 minutes until edges are set but centers still look soft.
Step 5
Cool on the pan 5 minutes, then transfer to a wire rack.
Tools you’ll need
- mixing bowl
- spoon
- sheet pan
- parchment paper
- oven
Cook smarter
Get matched recipes for what’s in your fridge
Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.
