Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Funfetti Pancakes

Fluffy vanilla pancakes studded with colorful sprinkles, ready in under 20 minutes. A festive breakfast that tastes like birthday cake without the fuss.

Total time
18 min
Servings
2
Calories
385
Protein
8g
Funfetti Pancakes
celebratorysimpleamericanvegetarianeggsfluffysoftBreakfast

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk flour, baking powder, sugar, and salt in a bowl until combined.

  2. Step 2

    In another bowl, whisk milk, egg, and vanilla until smooth.

  3. Step 3

    Pour wet ingredients into dry and fold until just combined; small lumps are fine.

  4. Step 4

    Fold in sprinkles gently with a few strokes—don't overmix.

  5. Step 5

    Heat butter in a skillet over medium until foamy, about 90 seconds.

  6. Step 6

    Pour 1/4-cup batter for each pancake; cook until edges look dry and bubbles appear, ~2 minutes.

  7. Step 7

    Flip once and cook the other side until golden brown, ~90 seconds.

  8. Step 8

    Transfer to a plate and repeat with remaining batter.

  9. Step 9

    Serve warm with syrup and extra sprinkles if desired.

Tools you’ll need

  • 2 medium bowls
  • whisk
  • rubber spatula
  • 12-inch nonstick skillet or griddle
  • spatula for flipping

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.