CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Garlic Butter Mushroom Bruschetta

Golden baguette slices topped with garlicky sautéed mushrooms and melted butter — crispy, savory, and ready in under 10 minutes. A no-fuss Italian snack that tastes like a fancy appetizer.

Total time
10 min
Servings
4
Calories
185
Protein
5g
Garlic Butter Mushroom Bruschetta
simplecasualitalianvegetariancrispytenderweeknightappetizer

Ingredients

  • 1 small (8 oz) baguette
  • 8 oz mushrooms, mixed varieties
  • 2 cloves garlic, minced
  • 3 tbsp butter

Instructions

  1. 1

    Slice the baguette diagonally into 1/4-inch-thick pieces.

  2. 2

    Toast baguette slices in a dry skillet over medium heat until golden, about 1 minute per side.

  3. 3

    Transfer toast to a plate, then add 2 tbsp butter and garlic to the same skillet.

  4. 4

    Cook garlic for 30 seconds until fragrant, then add sliced mushrooms with a pinch of salt.

  5. 5

    Sauté mushrooms, stirring occasionally, until golden and tender, about 4 minutes.

  6. 6

    Stir in the remaining 1 tbsp butter, then spoon warm mushrooms over each toast and serve immediately.

Tools you’ll need

  • 12-inch skillet or larger
  • cutting board
  • serrated knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.