Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Garlic Butter Mushroom Bruschetta

Golden baguette slices topped with garlicky sautéed mushrooms and melted butter — crispy, savory, and ready in under 10 minutes. A no-fuss Italian snack that tastes like a fancy appetizer.

Total time
10 min
Servings
4
Calories
185
Protein
5g
Garlic Butter Mushroom Bruschetta
simplecasualitalianvegetariancrispytenderweeknightappetizer

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Slice the baguette diagonally into 1/4-inch-thick pieces.

  2. Step 2

    Toast baguette slices in a dry skillet over medium heat until golden, about 1 minute per side.

  3. Step 3

    Transfer toast to a plate, then add 2 tbsp butter and garlic to the same skillet.

  4. Step 4

    Cook garlic for 30 seconds until fragrant, then add sliced mushrooms with a pinch of salt.

  5. Step 5

    Sauté mushrooms, stirring occasionally, until golden and tender, about 4 minutes.

  6. Step 6

    Stir in the remaining 1 tbsp butter, then spoon warm mushrooms over each toast and serve immediately.

Tools you’ll need

  • 12-inch skillet or larger
  • cutting board
  • serrated knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.