Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Garlic Oil Pasta with Crispy Shrimp

Aglio e olio meets the seafood version: spaghetti tossed in garlicky, peppery oil with quick-seared shrimp on top. Five minutes of high heat, done.

Total time
20 min
Servings
2
Calories
620
Protein
28g
Garlic Oil Pasta with Crispy Shrimp
quickelegantitalianshrimpcrispytenderweeknightpasta

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil salted water in a large pot, add spaghetti, and cook until al dente.

  2. Step 2

    While pasta cooks, warm oil in a skillet over medium heat, add garlic slices, and cook until golden and fragrant, about 2 minutes.

  3. Step 3

    Stir in red pepper flakes, then add shrimp in a single layer and sear until opaque, about 2 minutes per side.

  4. Step 4

    Drain pasta, reserving 1 cup pasta water, then add pasta to the skillet and toss with the oil.

  5. Step 5

    Add pasta water a splash at a time until the sauce coats the noodles and shrimp with a glossy sheen.

  6. Step 6

    Serve immediately, dividing shrimp evenly between plates.

Tools you’ll need

  • large pot
  • 12-inch skillet
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.