CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Garlic Oil Pasta with Crispy Shrimp

Aglio e olio meets the seafood version: spaghetti tossed in garlicky, peppery oil with quick-seared shrimp on top. Five minutes of high heat, done.

Total time
20 min
Servings
2
Calories
620
Protein
28g
Garlic Oil Pasta with Crispy Shrimp
quickelegantitalianshrimpcrispytenderweeknightpasta

Ingredients

  • 8 oz spaghetti
  • ⅓ cup olive oil
  • 6 cloves garlic, thinly sliced
  • ½ tsp red pepper flakes
  • 12 oz shrimp, peeled and deveined

Instructions

  1. 1

    Boil salted water in a large pot, add spaghetti, and cook until al dente.

  2. 2

    While pasta cooks, warm oil in a skillet over medium heat, add garlic slices, and cook until golden and fragrant, about 2 minutes.

  3. 3

    Stir in red pepper flakes, then add shrimp in a single layer and sear until opaque, about 2 minutes per side.

  4. 4

    Drain pasta, reserving 1 cup pasta water, then add pasta to the skillet and toss with the oil.

  5. 5

    Add pasta water a splash at a time until the sauce coats the noodles and shrimp with a glossy sheen.

  6. 6

    Serve immediately, dividing shrimp evenly between plates.

Tools you’ll need

  • large pot
  • 12-inch skillet
  • wooden spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.