Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Glossy Lemon Curd Tart with Torched Meringue

No-bake lemon tart with shop-bought shortbread base, silky lemon curd, and a quick meringue toasted with a kitchen torch. Served with whipped cream for richness.

Total time
20 min
Servings
6
Calories
385
Protein
4g
20-Min Glossy Lemon Curd Tart with Torched Meringue
elegantindulgentfrenchvegetariancrispysilkyfluffyDessert

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Spread lemon curd evenly into the shortbread shell, smoothing the top with a spatula.

  2. Step 2

    Beat egg whites and cream of tartar on medium-high speed until soft peaks form, ~2 minutes.

  3. Step 3

    Add sugar 1 tbsp at a time, beating between additions, until stiff glossy peaks form, ~3 minutes total.

  4. Step 4

    Fold lemon zest into meringue gently with a spatula until just combined.

  5. Step 5

    Pile meringue onto the tart, using the back of a spoon to create peaks and valleys.

  6. Step 6

    Use a kitchen torch to toast meringue until golden brown, moving constantly to avoid burning.

  7. Step 7

    Whip cold heavy cream to soft peaks and serve dolloped alongside each slice while tart cools 5 minutes.

Tools you’ll need

  • 9-inch tart pan with shortbread shell
  • electric mixer or whisk
  • rubber spatula
  • kitchen torch (culinary)
  • serving knife or offset spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.