Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Torched Lemon Curd Tarts with Quick Meringue

Glossy lemon curd in a buttery shell, crowned with torched meringue—no bake required. Four individual tarts in under 25 minutes using store-bought shells and a hand mixer.

Total time
25 min
Servings
4
Calories
310
Protein
4g
Torched Lemon Curd Tarts with Quick Meringue
elegantindulgentfrenchvegetariancrispycreamyfluffyDessert

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Spoon lemon curd evenly into the four tartlet shells until three-quarters full.

  2. Step 2

    Add egg whites and cream of tartar to a clean bowl. Beat with a hand mixer until soft peaks form, ~2 minutes.

  3. Step 3

    Gradually sprinkle in sugar while beating until stiff, glossy peaks form and the meringue looks like marshmallow fluff, ~3 minutes.

  4. Step 4

    Fold vanilla extract into meringue with a spatula, then top each tart with a generous dollop of meringue.

  5. Step 5

    Using a kitchen torch, slowly wave the flame over each meringue peak until lightly browned and blistered, ~30 seconds per tart.

  6. Step 6

    Sprinkle lemon zest over tops and serve immediately while meringue is still crispy and warm.

Tools you’ll need

  • 4 pre-baked tartlet shells
  • medium mixing bowl
  • hand mixer or whisk
  • rubber spatula
  • kitchen torch

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.