Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

15-Minute Lemon Curd Tart with Torched Meringue

No-bake lemon tart with glossy store-bought curd, crispy phyllo crust, and torched Italian meringue. Whipped cream on the side for serving.

Total time
15 min
Servings
4
Calories
285
Protein
4g
15-Minute Lemon Curd Tart with Torched Meringue
elegantindulgentfrenchvegetariancrispysilkycreamyfluffy

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Layer phyllo sheets on a tart pan, brushing each with melted butter. Bake at 375°F for 5 minutes until golden and crisp.

  2. Step 2

    Pour lemon curd into the cooled phyllo crust, spreading smooth. Chill while you make the meringue.

  3. Step 3

    Whisk egg whites with cream of tartar until foamy, about 30 seconds. Gradually add sugar, whisking until stiff peaks form.

  4. Step 4

    Spoon meringue onto the lemon curd filling, creating peaks and swirls.

  5. Step 5

    Use a kitchen torch to toast the meringue peaks until golden brown and charred in spots, 30-60 seconds.

  6. Step 6

    Serve immediately with a dollop of whipped cream on the side.

Tools you’ll need

  • 9-inch tart pan with removable bottom
  • pastry brush
  • kitchen torch
  • whisk
  • electric mixer (optional)

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.