Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Golden Baked Meatballs

Four-ingredient meatballs that bake golden and crispy without browning on the stovetop. Mix, shape, and bake—ready in under 25 minutes.

Total time
22 min
Servings
4
Calories
285
Protein
24g
Golden Baked Meatballs
comfortsimpleamericanbeefcrispytenderweeknightmain-dish

Ingredients

4 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F and line a baking sheet with parchment paper.

  2. Step 2

    Mix ground beef, breadcrumbs, egg, and parmesan with a pinch of salt and pepper until just combined.

  3. Step 3

    Roll the mixture into 1.5-inch balls and space them 1 inch apart on the baking sheet.

  4. Step 4

    Bake 15-18 minutes until the edges turn deep golden and the centers are cooked through.

  5. Step 5

    Serve hot with marinara, ranch, or your favorite dipping sauce.

Tools you’ll need

  • oven
  • baking sheet
  • parchment paper
  • mixing bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.