CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Golden Baked Meatballs

Four-ingredient meatballs that bake golden and crispy without browning on the stovetop. Mix, shape, and bake—ready in under 25 minutes.

Total time
22 min
Servings
4
Calories
285
Protein
24g
Golden Baked Meatballs
comfortsimpleamericanbeefcrispytenderweeknightmain-dish

Ingredients

  • 1 lb ground beef
  • ½ cup breadcrumbs
  • 1 whole egg
  • ¼ cup parmesan cheese, grated

Instructions

  1. 1

    Preheat oven to 400°F and line a baking sheet with parchment paper.

  2. 2

    Mix ground beef, breadcrumbs, egg, and parmesan with a pinch of salt and pepper until just combined.

  3. 3

    Roll the mixture into 1.5-inch balls and space them 1 inch apart on the baking sheet.

  4. 4

    Bake 15-18 minutes until the edges turn deep golden and the centers are cooked through.

  5. 5

    Serve hot with marinara, ranch, or your favorite dipping sauce.

Tools you’ll need

  • oven
  • baking sheet
  • parchment paper
  • mixing bowl
  • spoon

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.