Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Golden Butter Croissants

Buttery, flaky croissants with caramelized edges, baked until golden in under 20 minutes using store-bought puff pastry. A French bakery moment on a weeknight.

Total time
18 min
Servings
4
Calories
298
Protein
4g
Golden Butter Croissants
indulgentelegantfrenchvegetariancrispyflakybutteryweeknight

Ingredients

5 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 400°F. Line a sheet pan with parchment paper.

  2. Step 2

    Unfold thawed puff pastry on a work surface. Cut each sheet into 4 triangles.

  3. Step 3

    Starting at the wide end, roll each triangle tightly into a croissant shape, curving the tips.

  4. Step 4

    Place croissants 2 inches apart on the sheet pan. Brush with beaten egg until glossy.

  5. Step 5

    Mix melted butter, sugar, and salt. Drizzle over croissants before baking.

  6. Step 6

    Bake 12–15 minutes until deep golden brown and crispy. Serve warm.

Tools you’ll need

  • sheet pan
  • parchment paper
  • chef's knife
  • pastry brush
  • small bowl
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.