Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Greek Greens with Lemon & Olive Oil

A simple, bright Greek boiled greens dish with lemon-olive oil drizzle. Tender, mineral-rich, and ready in under 20 minutes — the weeknight version of horta.

Total time
18 min
Servings
4
Calories
185
Protein
4g
Greek Greens with Lemon & Olive Oil
lightwholesomegreekvegetarianvegandairy-freegluten-freetender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Rinse the greens thoroughly and trim any tough stems from the bottom half.

  2. Step 2

    Bring a large pot of water to a boil with 2 tsp salt and the lemon halves.

  3. Step 3

    Add greens in batches, pushing them down until submerged. Boil until tender, 10–12 minutes total.

  4. Step 4

    Drain greens in a colander. Let sit 1 minute to release excess water.

  5. Step 5

    Warm olive oil and minced garlic in a small skillet over low heat for 1 minute until fragrant.

  6. Step 6

    Transfer drained greens to a serving plate. Drizzle with garlic oil and red pepper flakes. Squeeze fresh lemon juice over top and serve immediately.

Tools you’ll need

  • large pot
  • colander
  • small skillet
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.