CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Greek Greens with Lemon & Olive Oil

A simple, bright Greek boiled greens dish with lemon-olive oil drizzle. Tender, mineral-rich, and ready in under 20 minutes — the weeknight version of horta.

Total time
18 min
Servings
4
Calories
185
Protein
4g
Greek Greens with Lemon & Olive Oil
lightwholesomegreekvegetarianvegandairy-freegluten-freetender

Ingredients

  • 1.5 lbs mixed hardy greens (spinach, kale, chard, or dandelion)
  • 2 tsp salt
  • 1 whole lemon (halved)
  • ⅓ cup extra-virgin olive oil
  • 3 cloves garlic cloves, minced
  • ¼ tsp red pepper flakes (optional)

Instructions

  1. 1

    Rinse the greens thoroughly and trim any tough stems from the bottom half.

  2. 2

    Bring a large pot of water to a boil with 2 tsp salt and the lemon halves.

  3. 3

    Add greens in batches, pushing them down until submerged. Boil until tender, 10–12 minutes total.

  4. 4

    Drain greens in a colander. Let sit 1 minute to release excess water.

  5. 5

    Warm olive oil and minced garlic in a small skillet over low heat for 1 minute until fragrant.

  6. 6

    Transfer drained greens to a serving plate. Drizzle with garlic oil and red pepper flakes. Squeeze fresh lemon juice over top and serve immediately.

Tools you’ll need

  • large pot
  • colander
  • small skillet
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.