Custrd is out on the App Store — Download it free →
Back to recipes

Grilled Chicken with Vegetables and Fries

Juicy grilled chicken breast served with crispy oven fries and a colorful mix of sautéed vegetables. A simple, balanced weeknight dinner that's ready in about 40 minutes.

Total time
40 min
Servings
2
Calories
550
Protein
40g
Grilled Chicken with Vegetables and Fries
comfortingamericangluten-freechickencrispytenderweeknightmain course

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Cut the 2 potatoes into thin fries, toss with 1 tbsp olive oil and 1/2 tsp salt, and spread on a baking sheet.

  2. Step 2

    Bake fries for 25-30 minutes, flipping halfway, until golden and crisp on the edges.

  3. Step 3

    While fries bake, slice the 1 carrot, 1 zucchini, 1 cucumber, and 1 onion into thin strips.

  4. Step 4

    Heat 1 tbsp olive oil in a large skillet over medium-high heat. Add the sliced vegetables and 1/4 tsp salt. Cook, stirring, until tender-crisp, about 5-7 minutes. Remove to a plate.

  5. Step 5

    Season the 2 chicken breasts with remaining 1/4 tsp salt and black pepper if desired. Heat 1 tbsp olive oil in the same skillet over medium-high heat.

  6. Step 6

    Grill chicken for 6-7 minutes per side, until golden and cooked through (no pink inside).

  7. Step 7

    Serve the chicken with the vegetables and fries on the side.

Tools you’ll need

  • baking sheet
  • large skillet
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.