Custrd is out on the App Store — Download it free →
Back to recipes

Lemon Garlic Chicken Wings

Crispy baked chicken wings tossed in a tangy lemon-garlic sauce, served with caramelized onions and a hint of heat. A simple weeknight dinner that's full of flavor.

Total time
40 min
Servings
4
Calories
420
Protein
28g
Lemon Garlic Chicken Wings
comfortingsavoryamericangluten-freechickencrispytenderweeknight

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Preheat oven to 425°F. Pat dry 2 lb chicken wings with paper towels. In a large bowl, toss wings with 1 tbsp olive oil, 1 tsp salt, and 0.5 tsp black pepper.

  2. Step 2

    Arrange wings in a single layer on a baking sheet lined with parchment. Bake for 25-30 minutes, flipping halfway, until golden and crispy.

  3. Step 3

    While wings bake, slice 1 medium onion into rings. Zest and juice 2 lemons. Mince 4 garlic cloves.

  4. Step 4

    In a skillet over medium heat, add 1 tbsp olive oil and the onion rings. Cook, stirring occasionally, until soft and golden, about 8 minutes. Add garlic and cook 1 minute until fragrant.

  5. Step 5

    Stir in lemon juice, lemon zest, and 0.5 tsp chili flakes. Simmer for 2 minutes until slightly thickened.

  6. Step 6

    Add baked wings to the skillet and toss to coat in the sauce. Cook for 2-3 minutes until wings are glazed and heated through.

  7. Step 7

    Serve hot, garnished with extra lemon wedges if desired.

Tools you’ll need

  • baking sheet
  • parchment paper
  • large bowl
  • skillet
  • knife
  • cutting board
  • zester
  • citrus juicer

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.