Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Grilled Denis Fish with Lemon, Rice & Farofa

Whole sea bream grilled until crispy-skinned and flaky, served over fluffy rice with toasted farofa and bright lemon-herb oil. Restaurant-style Israeli grilled fish that tastes like the coast.

Total time
25 min
Servings
2
Calories
680
Protein
48g
Grilled Denis Fish with Lemon, Rice & Farofa
elegantlightisraelimediterraneanfishcrispyflakytender

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Start rice in a pot with 2 cups salted water; bring to boil, then reduce heat to low, cover, and cook until tender, ~18 minutes.

  2. Step 2

    Pat fish dry inside and out. Score skin diagonally 2–3 times. Season generously with salt and pepper inside the cavity and all over.

  3. Step 3

    Heat a grill or grill pan over medium-high until very hot. Lightly oil the grates, then place fish on grill.

  4. Step 4

    Grill 6–7 minutes per side without moving until skin is golden and crispy and flesh flakes easily at the thickest part.

  5. Step 5

    Whisk together olive oil, lemon zest, lemon juice, and fresh herbs. Drizzle over finished fish.

  6. Step 6

    Serve fish over rice alongside farofa, lime wedges, and tomato slices. Finish with extra herb oil and flake of salt.

Tools you’ll need

  • pot with lid
  • grill or grill pan
  • small bowl for herb oil
  • whisk
  • cutting board
  • chef's knife
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.