Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Grilled Lemon Herb Fish with Crispy Skin

Whole sea bream or similar white fish charred over high heat with fresh lemon, herbs, and olive oil — the Israeli way. Flaky, bright, and ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
285
Protein
38g
Grilled Lemon Herb Fish with Crispy Skin
elegantsimpleisraelimediterraneanfishcrispyflakytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat fish dry inside and out with paper towels. Score the skin crosswise three times on each side.

  2. Step 2

    Heat a grill or grill pan over high heat until it smokes lightly, about 3 minutes.

  3. Step 3

    Mix olive oil, garlic, and chopped herbs in a small bowl. Rub all over fish, inside and out. Season generously with salt and pepper.

  4. Step 4

    Slice half the lemon into thin rounds. Stuff inside each fish cavity. Place fish on hot grill skin-side down.

  5. Step 5

    Sear 5–6 minutes without moving until skin is charred and crispy. Flip once and cook 3–4 minutes more until flesh flakes easily.

  6. Step 6

    Transfer to a plate. Squeeze remaining lemon juice over fish and serve immediately.

Tools you’ll need

  • grill or grill pan
  • paper towels
  • small mixing bowl
  • fish spatula
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.