Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Grilled Sea Bream with Charred Lemon

Whole sea bream rubbed with herbs and olive oil, grilled until the skin crisps and flesh flakes. Charred lemon slices finish the plate with bright acidity and a rustic Israeli seaside vibe.

Total time
18 min
Servings
2
Calories
285
Protein
32g
Grilled Sea Bream with Charred Lemon
freshelegantsimpleisraelifishcrispyflakytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat fish dry inside and out with paper towels. Season generously with salt, pepper, and minced garlic.

  2. Step 2

    Stuff each fish cavity with half the chopped herbs. Brush skin and lemon slices generously with olive oil.

  3. Step 3

    Heat grill or grill pan to medium-high until oil shimmers when flicked on the surface, about 2 minutes.

  4. Step 4

    Grill fish 5 minutes per side without moving. Skin should be charred and opaque; flesh flakes when prodded.

  5. Step 5

    Grill lemon slices 2 minutes per side until caramelized and soft.

  6. Step 6

    Transfer fish to a plate. Arrange charred lemon alongside and drizzle with any pan juices. Serve hot.

Tools you’ll need

  • grill or grill pan
  • tongs
  • paper towels
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.