Custrd is out on the App Store — Download it free →
Back to recipes

Grilled Eel Rice Bowl

A quick and satisfying bowl of rice topped with savory grilled eel, pickled ginger, and crisp vegetables. Perfect for a weeknight dinner that feels special.

Total time
15 min
Servings
2
Calories
550
Protein
25g
Grilled Eel Rice Bowl
comfortingJapanesepescatarianfishtendercrispweeknightmain course

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    In a small bowl, mix the 1 tbsp soy sauce and 1 tbsp mirin. Brush this glaze over the 8 oz grilled eel.

  2. Step 2

    Place the eel on a baking sheet and broil for 3-4 minutes until the glaze bubbles and the edges are slightly charred.

  3. Step 3

    Divide the 2 cups cooked sushi rice between two bowls.

  4. Step 4

    Slice the broiled eel into 1-inch pieces and arrange over the rice.

  5. Step 5

    Top each bowl with 1 tbsp pickled ginger, 1/2 cup shredded daikon, and 1 oz sliced kamaboko.

  6. Step 6

    Tear the 4 shiso leaves and scatter over the bowls. Serve immediately.

  7. Step 7

    Optional: add a sprinkle of sesame seeds or a drizzle of extra soy sauce if you like.

Tools you’ll need

  • small bowl
  • baking sheet
  • broiler
  • knife
  • cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.