Custrd is out on the App Store — Download it free →
Back to recipes

Chirashi Don

A quick and colorful bowl of sushi rice topped with fresh raw fish, salmon roe, and classic garnishes. Perfect for a fast weeknight dinner or a special lunch.

Total time
15 min
Servings
2
Calories
450
Protein
30g
Chirashi Don
freshlightJapanesepescatarianfishtenderchewyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Prepare 2 cups cooked sushi rice and spread it warm in a serving bowl.

  2. Step 2

    Thinly slice 8 oz sashimi-grade fish and arrange the slices over the rice.

  3. Step 3

    Top with 2 tbsp salmon roe, 4 shiso leaves, and 1 nori sheet torn into pieces.

  4. Step 4

    Serve with 2 tbsp soy sauce and a small mound of wasabi on the side.

  5. Step 5

    Mix everything together just before eating, adding soy sauce to taste.

Tools you’ll need

  • sharp knife
  • serving bowl

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.