Custrd is out on the App Store — Download it free →
Back to recipes

Grilled Rice Cake

A savory grilled rice cake wrapped in banana leaf, filled with seasoned meat. A quick and flavorful snack or light meal.

Total time
20 min
Servings
2
Calories
450
Protein
22g
Grilled Rice Cake
comfortingIndonesianbeefchewycrispyweeknightmainsnack

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mince the 2 garlic cloves and mix with the 0.5 lb ground beef, 2 tbsp sweet soy sauce, and 0.5 tsp salt in a bowl until well combined.

  2. Step 2

    Cook the seasoned beef in a skillet over medium-high heat, breaking it up, until browned and cooked through, about 5-7 minutes.

  3. Step 3

    Soften the 4 banana leaves by passing them over a flame or dipping in hot water for a few seconds until pliable.

  4. Step 4

    Place a portion of the 2 cups cooked rice on each leaf, flatten, add a spoonful of the cooked beef in the center, then fold the leaf over to form a packet.

  5. Step 5

    Grill the packets over medium heat for 3-4 minutes per side, until the leaf is charred and the rice is heated through. Serve hot.

Tools you’ll need

  • skillet
  • mixing bowl
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.