Custrd is out on the App Store — Download it free →
Back to recipes

Grilled Shrimp with Mashed Potatoes and Vegetables

Juicy grilled shrimp served over creamy mashed potatoes with tender broccoli and carrots. A quick, satisfying meal that's ready in about 20 minutes.

Total time
20 min
Servings
2
Calories
380
Protein
28g
Grilled Shrimp with Mashed Potatoes and Vegetables
comfortingquickAmericangluten-freeshrimpcreamytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Boil the 2 cubed potatoes in salted water until fork-tender, about 12 minutes. Drain and mash with 1 tbsp butter and a splash of the cooking water; season with salt and pepper.

  2. Step 2

    Steam the 1 cup broccoli and 1 sliced carrot until crisp-tender, about 5 minutes. Set aside.

  3. Step 3

    Toss the 12 shrimp with 1 tbsp butter, 2 minced garlic cloves, salt, and pepper. Grill in a hot skillet for 2-3 minutes per side until pink and opaque.

  4. Step 4

    Plate the mashed potatoes, top with the vegetables and grilled shrimp. Drizzle any pan juices over the top and serve hot.

  5. Step 5

    Garnish with fresh herbs like parsley or chives if you have them.

Tools you’ll need

  • pot
  • steamer basket
  • skillet or grill pan
  • masher

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.