Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

20-Min Hawaiian Fried Rice

Crispy fried rice loaded with ham, shrimp, pineapple, and eggs — sweet, savory, and ready in one skillet. A TikTok-easy dinner that tastes like vacation.

Total time
20 min
Servings
4
Calories
428
Protein
26g
20-Min Hawaiian Fried Rice
casualfreshhawaiianshrimphameggscrispytender

Ingredients

8 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Heat oil in a large skillet over medium-high heat until it shimmers, ~60 seconds.

  2. Step 2

    Add shrimp and cook, stirring occasionally, until pink and cooked through, ~3 minutes.

  3. Step 3

    Push shrimp to the side. Crack eggs into the pan and scramble until just set, ~2 minutes.

  4. Step 4

    Add rice, breaking up clumps with the back of a spoon, and stir-fry for 2 minutes.

  5. Step 5

    Toss in ham, pineapple, soy sauce, and scallions. Stir everything together for 1 minute until hot.

  6. Step 6

    Serve immediately while steam is still rising.

Tools you’ll need

  • 12-inch skillet or wok
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.