Custrd is out on the App Store — Download it free →
Back to recipes

Hawaiian Huli Huli Chicken

Sweet and tangy grilled chicken with pineapple and coconut rice, ready in about 20 minutes. A quick tropical dinner that tastes like a vacation.

Total time
20 min
Servings
4
Calories
550
Protein
35g
Hawaiian Huli Huli Chicken
comfortingtropicalhawaiiandairy-freechickenjuicytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    In a bowl, whisk 1/2 cup pineapple juice, 1/4 cup soy sauce, and 2 tbsp brown sugar. Add 1.5 lb chicken thighs and toss to coat.

  2. Step 2

    Meanwhile, cook 1 cup rice with 1 cup coconut milk and 1 cup water in a pot. Bring to a boil, then simmer covered until tender, about 15 minutes.

  3. Step 3

    Heat a grill or grill pan over medium-high. Cook the chicken for 6-7 minutes per side, until charred and cooked through (165°F).

  4. Step 4

    Serve the chicken over the coconut rice with grilled pineapple slices if you like.

Tools you’ll need

  • grill or grill pan
  • pot with lid
  • bowl
  • whisk

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.