Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Honey Garlic Roasted Chicken

Vietnamese-style chicken thighs glazed with honey, fish sauce, and garlic, roasted until caramelized and sticky. Ready in under 30 minutes with crispy skin and tender meat.

Total time
28 min
Servings
4
Calories
385
Protein
42g
Honey Garlic Roasted Chicken
comfortsatisfyingvietnamesechickencrispytenderjuicyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken thighs dry with paper towels. Season generously with salt and black pepper on both sides.

  2. Step 2

    Whisk honey, fish sauce, minced garlic, and juice from half the lime in a small bowl until combined.

  3. Step 3

    Arrange chicken skin-side up on a sheet pan. Brush the glaze over each piece, coating well.

  4. Step 4

    Roast at 425°F for 18–20 minutes until skin is golden-brown and an instant-read thermometer reads 165°F in the thickest part.

  5. Step 5

    Scatter sliced shallot over the chicken. Squeeze remaining lime over top and serve immediately.

Tools you’ll need

  • sheet pan
  • paper towels
  • small mixing bowl
  • whisk
  • instant-read thermometer
  • oven

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.