Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Honey-Roasted Chicken Thighs

Vietnamese-style chicken roasted with honey, garlic, and a touch of fish sauce until sticky and caramelized. Ready in under 30 minutes with a glossy glaze that screams TikTok.

Total time
25 min
Servings
2
Calories
380
Protein
32g
Honey-Roasted Chicken Thighs
comfortsatisfyingvietnamesechickencrispyjuicytenderweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken thighs dry and season generously with salt and pepper on both sides.

  2. Step 2

    Heat oil in a large skillet over medium-high heat until shimmering, about 1 minute.

  3. Step 3

    Place chicken skin-side down in the skillet and sear without moving until golden, 6–7 minutes.

  4. Step 4

    Flip chicken. Mix honey, garlic, fish sauce, lime juice, and chili in a small bowl, then pour over thighs.

  5. Step 5

    Cook 8–10 minutes until glaze caramelizes and chicken reaches 165°F at the thickest point.

  6. Step 6

    Spoon glaze over chicken, then serve immediately while the skin is crispy.

Tools you’ll need

  • 12-inch skillet or large frying pan
  • meat thermometer (optional but recommended)
  • small bowl for mixing glaze

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.