Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Honey Msemen with Cheese & Veg Plate

Crispy, flaky Moroccan flatbread finished with warm honey and served alongside fresh cucumbers, tomatoes, olives, and cheese. A 15-minute breakfast that tastes like a souk.

Total time
15 min
Servings
2
Calories
420
Protein
9g
Honey Msemen with Cheese & Veg Plate
rusticcozymoroccanvegetariancheesecrispyflakybuttery

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour with 0.5 cup water and a pinch of salt until a rough dough forms. Let rest 2 minutes.

  2. Step 2

    Knead dough for 1 minute until smooth. Divide into 2 balls and cover with a damp towel.

  3. Step 3

    On an oiled surface, stretch one dough ball into a thin 8×8-inch square. Fold into thirds, then fold again into a small square.

  4. Step 4

    Heat 1.5 tbsp melted butter in a skillet over medium-high. Pan-fry the folded dough 2–3 minutes per side until deep golden and crispy.

  5. Step 5

    Transfer to a plate. Repeat step 3–4 with the second dough ball and remaining butter. Drizzle both with warm honey.

  6. Step 6

    Arrange cucumber, tomato, cheese, and olives on the plate alongside the msemen. Serve warm.

Tools you’ll need

  • medium mixing bowl
  • 12-inch nonstick skillet or cast iron
  • knife and cutting board
  • damp towel
  • wooden spoon or spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.