Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Msemen with Honey & Fresh Salad

Flaky, buttery square flatbread fried until golden, drizzled with warm honey and served alongside a bright cucumber-tomato salad. A Moroccan breakfast classic that feels fancy but takes just 20 minutes.

Total time
20 min
Servings
2
Calories
420
Protein
6g
Crispy Msemen with Honey & Fresh Salad
simpleelegantcozymoroccanvegetariancrispyflakytender

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour with 0.5 cup water and a pinch of salt until a soft dough forms, then knead for 2 minutes until smooth.

  2. Step 2

    Divide dough into 2 balls. On an oiled surface, stretch one ball thin with your hands, then fold into a square.

  3. Step 3

    Heat 2 tbsp butter in a 12-inch skillet over medium-high until it shimmers, about 90 seconds.

  4. Step 4

    Pan-fry msemen 3–4 minutes per side until golden brown and crispy. Repeat with remaining dough and butter.

  5. Step 5

    While msemen cooks, toss cucumber and tomato slices with salt, pepper, and fresh herbs in a bowl.

  6. Step 6

    Drizzle warm honey over cooked msemen. Serve hot alongside the cucumber-tomato salad.

Tools you’ll need

  • mixing bowl
  • 12-inch skillet
  • cutting board
  • knife

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.