Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Msemen with Honey & Marinated Vegetables

Buttery, flaky pan-fried msemen served warm with warm honey drizzle, plus a quick-pickled vegetable plate of tomatoes, cucumbers, olives, tapenade, and peppers. Pure breakfast comfort.

Total time
20 min
Servings
2
Calories
520
Protein
8g
Crispy Msemen with Honey & Marinated Vegetables
comfortrusticmoroccanvegetariancrispyflakytenderbreakfast

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Mix flour with 0.5 tsp salt and 0.5 cup water to form a soft dough. Knead for 2 minutes until smooth.

  2. Step 2

    Divide dough in half. Roll each piece into a thin rectangle, spread 1 tbsp softened butter over it, then fold and roll again into a rough square.

  3. Step 3

    Heat 1 tbsp oil in a large skillet over medium-high heat. Pan-fry each msemen 3–4 minutes per side until golden and crispy.

  4. Step 4

    Arrange sliced tomatoes, cucumber, olives, tapenade, and pickled peppers on a plate alongside the warm msemen.

  5. Step 5

    Warm honey in a small bowl (30 seconds in microwave or over low heat) and drizzle over the msemen.

  6. Step 6

    Serve immediately while msemen is still warm and crispy.

Tools you’ll need

  • large mixing bowl
  • 12-inch nonstick or cast-iron skillet
  • rolling pin or hand
  • small bowl for honey
  • plate for serving

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.