CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Crispy Msemen with Honey & Marinated Vegetables

Buttery, flaky pan-fried msemen served warm with warm honey drizzle, plus a quick-pickled vegetable plate of tomatoes, cucumbers, olives, tapenade, and peppers. Pure breakfast comfort.

Total time
20 min
Servings
2
Calories
520
Protein
8g
Crispy Msemen with Honey & Marinated Vegetables
comfortrusticmoroccanvegetariancrispyflakytenderbreakfast

Ingredients

  • 1.5 cups all-purpose flour
  • 4 tbsp butter, softened
  • 3 tbsp honey
  • 1 cup cherry tomatoes, sliced
  • 1 medium cucumber, sliced
  • ½ cup black olives
  • ½ cup total tapenade and pickled peppers

Instructions

  1. 1

    Mix flour with 0.5 tsp salt and 0.5 cup water to form a soft dough. Knead for 2 minutes until smooth.

  2. 2

    Divide dough in half. Roll each piece into a thin rectangle, spread 1 tbsp softened butter over it, then fold and roll again into a rough square.

  3. 3

    Heat 1 tbsp oil in a large skillet over medium-high heat. Pan-fry each msemen 3–4 minutes per side until golden and crispy.

  4. 4

    Arrange sliced tomatoes, cucumber, olives, tapenade, and pickled peppers on a plate alongside the warm msemen.

  5. 5

    Warm honey in a small bowl (30 seconds in microwave or over low heat) and drizzle over the msemen.

  6. 6

    Serve immediately while msemen is still warm and crispy.

Tools you’ll need

  • large mixing bowl
  • 12-inch nonstick or cast-iron skillet
  • rolling pin or hand
  • small bowl for honey
  • plate for serving

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.