Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Honey Roasted Chicken with Cucumber

Sticky-glazed chicken thighs with a bright honey-soy coating, roasted until caramelized and served with cool cucumber slices. Ready in under 25 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
38g
Honey Roasted Chicken with Cucumber
satisfyingcasualvietnamesechickencrispytenderjuicyweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken dry with paper towels. Season both sides generously with salt and black pepper.

  2. Step 2

    Whisk honey, soy sauce, fish sauce, and minced garlic in a small bowl until combined.

  3. Step 3

    Heat oil in a large skillet over medium-high until shimmering, about 90 seconds.

  4. Step 4

    Sear chicken thighs 3–4 minutes per side without moving until golden brown on both sides.

  5. Step 5

    Pour honey-soy glaze over chicken. Reduce heat to medium and cook 5–6 minutes until glaze thickens and coats the meat.

  6. Step 6

    Serve chicken hot, topped with pan glaze, alongside cool cucumber slices.

Tools you’ll need

  • 12-inch skillet
  • small mixing bowl
  • whisk
  • paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.