Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Honey Roasted Chicken with Root Vegetables

Vietnamese-inspired sheet-pan dinner with caramelized honey-glazed chicken thighs and roasted potatoes, carrots, and zucchini. Ready in under 20 minutes.

Total time
18 min
Servings
2
Calories
520
Protein
42g
Honey Roasted Chicken with Root Vegetables
comfortsatisfyingvietnamesechickencrispytendercaramelizedweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat chicken thighs dry with paper towels. Season all sides generously with salt and pepper.

  2. Step 2

    Whisk honey and soy sauce together in a small bowl until combined.

  3. Step 3

    Arrange potatoes, carrots, and zucchini on a sheet pan. Drizzle with 1 tbsp oil, toss, and push to the sides.

  4. Step 4

    Place chicken thighs skin-side up in the center of the pan. Brush with honey-soy mixture.

  5. Step 5

    Roast at 425°F until chicken skin is dark golden and an instant-read thermometer reads 165°F at the thickest part, 12–14 minutes.

  6. Step 6

    Serve chicken and vegetables hot, drizzling any pan juices over the top.

Tools you’ll need

  • sheet pan (18×13 inch)
  • instant-read thermometer
  • small mixing bowl
  • measuring spoons
  • tongs

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.