Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Crispy Spiced Fish — Ikan Woku

Whole fish crisped in a skillet, then tossed with a fragrant aromatics and spice paste that clings to every golden edge. Manado-style, ready in under 25 minutes.

Total time
25 min
Servings
2
Calories
385
Protein
42g
Crispy Spiced Fish — Ikan Woku
boldfreshindonesianfishcrispytenderweeknightdinner

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the fish dry inside and out with paper towels. Score the sides diagonally 3–4 times to help it crisp.

  2. Step 2

    Season the fish generously with salt and pepper, inside the cavity and on both sides.

  3. Step 3

    Heat oil in a large skillet over medium-high until it shimmers, about 90 seconds.

  4. Step 4

    Lay the fish in the skillet and sear without moving for 5–6 minutes until the skin is golden and crispy.

  5. Step 5

    Flip the fish carefully and cook the other side another 4–5 minutes until the flesh flakes easily at the thickest part.

  6. Step 6

    Push the fish to the side of the skillet. Add shallots, garlic, chili, and turmeric to the empty space; stir constantly for 60 seconds until fragrant.

  7. Step 7

    Toss the aromatics over the fish until coated, breaking up any clumps. Squeeze lime over the top and serve immediately.

Tools you’ll need

  • large skillet (12–14 inches)
  • paper towels
  • knife and cutting board
  • wooden spoon or silicone spatula

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.