Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Kale Caesar Salad

Crispy kale tossed with a garlicky, lemony Caesar dressing and crunchy croutons. Ready in 15 minutes—no raw eggs, no fuss.

Total time
15 min
Servings
4
Calories
280
Protein
9g
Kale Caesar Salad
freshlightmediterraneanvegetariancheesecrispycrunchySalad

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk lemon juice, minced garlic, and 2 pinches of salt in a small bowl.

  2. Step 2

    Drizzle in olive oil while whisking until emulsified and creamy.

  3. Step 3

    Remove kale stems, then roughly chop or tear leaves into bite-sized pieces.

  4. Step 4

    Place kale in a large bowl and pour dressing over it.

  5. Step 5

    Massage kale with your hands for 30 seconds until leaves soften and darken.

  6. Step 6

    Toss in croutons and half the Parmesan. Taste and add salt and pepper as needed.

  7. Step 7

    Divide among bowls and top with remaining Parmesan. Serve immediately.

Tools you’ll need

  • small bowl
  • whisk
  • large mixing bowl
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.