Kale Caesar Salad
Crispy kale tossed with a garlicky, lemony Caesar dressing and crunchy croutons. Ready in 15 minutes—no raw eggs, no fuss.
- Total time
- 15 min
- Servings
- 4
- Calories
- 280
- Protein
- 9g

freshlightmediterraneanvegetariancheesecrispycrunchySalad
Ingredients
- 1 large bunch (about 8 oz) kale, lacinato or curly
- 1.5 cups croutons, store-bought or homemade
- ½ cup Parmesan cheese, finely grated
- 1 whole (juiced) lemon
- 2 cloves garlic, minced
- ¼ cup olive oil
Instructions
- 1
Whisk lemon juice, minced garlic, and 2 pinches of salt in a small bowl.
- 2
Drizzle in olive oil while whisking until emulsified and creamy.
- 3
Remove kale stems, then roughly chop or tear leaves into bite-sized pieces.
- 4
Place kale in a large bowl and pour dressing over it.
- 5
Massage kale with your hands for 30 seconds until leaves soften and darken.
- 6
Toss in croutons and half the Parmesan. Taste and add salt and pepper as needed.
- 7
Divide among bowls and top with remaining Parmesan. Serve immediately.
Tools you’ll need
- small bowl
- whisk
- large mixing bowl
- knife and cutting board
Cook smarter
Get matched recipes for what’s in your fridge
CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.



