CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Kale Caesar Salad

Crispy kale tossed with a garlicky, lemony Caesar dressing and crunchy croutons. Ready in 15 minutes—no raw eggs, no fuss.

Total time
15 min
Servings
4
Calories
280
Protein
9g
Kale Caesar Salad
freshlightmediterraneanvegetariancheesecrispycrunchySalad

Ingredients

  • 1 large bunch (about 8 oz) kale, lacinato or curly
  • 1.5 cups croutons, store-bought or homemade
  • ½ cup Parmesan cheese, finely grated
  • 1 whole (juiced) lemon
  • 2 cloves garlic, minced
  • ¼ cup olive oil

Instructions

  1. 1

    Whisk lemon juice, minced garlic, and 2 pinches of salt in a small bowl.

  2. 2

    Drizzle in olive oil while whisking until emulsified and creamy.

  3. 3

    Remove kale stems, then roughly chop or tear leaves into bite-sized pieces.

  4. 4

    Place kale in a large bowl and pour dressing over it.

  5. 5

    Massage kale with your hands for 30 seconds until leaves soften and darken.

  6. 6

    Toss in croutons and half the Parmesan. Taste and add salt and pepper as needed.

  7. 7

    Divide among bowls and top with remaining Parmesan. Serve immediately.

Tools you’ll need

  • small bowl
  • whisk
  • large mixing bowl
  • knife and cutting board

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.