Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Classic Caesar Salad

Crisp romaine tossed with a tangy, garlicky dressing made from scratch and topped with crunchy croutons and sharp Parmesan. Ready in 15 minutes.

Total time
15 min
Servings
4
Calories
285
Protein
9g
Classic Caesar Salad
freshlightmediterraneanvegetariancrispycrunchySaladweeknight

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Whisk together minced garlic, lemon juice, anchovy paste, 0.5 tsp salt, and black pepper in a small bowl.

  2. Step 2

    Slowly whisk in 5 tbsp olive oil until the dressing emulsifies and looks creamy.

  3. Step 3

    Toss chopped romaine with dressing in a large bowl until every leaf is coated evenly.

  4. Step 4

    Divide salad among serving bowls. Top with croutons and grated Parmesan.

  5. Step 5

    Serve immediately.

Tools you’ll need

  • small mixing bowl
  • whisk
  • large mixing bowl
  • serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.