CookSnap is in beta — Get it free on TestFlight →
Back to recipes

Classic Caesar Salad

Crisp romaine tossed with a tangy, garlicky dressing made from scratch and topped with crunchy croutons and sharp Parmesan. Ready in 15 minutes.

Total time
15 min
Servings
4
Calories
285
Protein
9g
Classic Caesar Salad
freshlightmediterraneanvegetariancrispycrunchySaladweeknight

Ingredients

  • 1 head romaine lettuce, chopped
  • ½ cup Parmesan cheese, finely grated
  • 2 cloves garlic, minced
  • 3 tbsp lemon juice
  • 1 tsp anchovy paste or Worcestershire sauce
  • 1.5 cups croutons, store-bought or homemade

Instructions

  1. 1

    Whisk together minced garlic, lemon juice, anchovy paste, 0.5 tsp salt, and black pepper in a small bowl.

  2. 2

    Slowly whisk in 5 tbsp olive oil until the dressing emulsifies and looks creamy.

  3. 3

    Toss chopped romaine with dressing in a large bowl until every leaf is coated evenly.

  4. 4

    Divide salad among serving bowls. Top with croutons and grated Parmesan.

  5. 5

    Serve immediately.

Tools you’ll need

  • small mixing bowl
  • whisk
  • large mixing bowl
  • serving bowls

Cook smarter

Get matched recipes for what’s in your fridge

CookSnap is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.