Custrd is out now on the App Store and Google Play — Try it free for 7 days →
Back to recipes

Classic Caesar Salad

Crisp romaine with a tangy, garlicky Caesar dressing made in seconds. Top with crunchy croutons and parmesan for a restaurant-quality salad in under 15 minutes.

Total time
12 min
Servings
2
Calories
280
Protein
8g
Classic Caesar Salad
freshlightmediterraneanvegetariancrispycrunchySaladweeknight

Ingredients

7 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Chop romaine into bite-sized pieces. Rinse and pat dry thoroughly.

  2. Step 2

    Whisk minced garlic with lemon juice in a large bowl until combined.

  3. Step 3

    Add olive oil to the garlic-lemon mixture and whisk until emulsified.

  4. Step 4

    Add romaine to the bowl with dressing and toss until every leaf glistens.

  5. Step 5

    Season with salt and pepper to taste.

  6. Step 6

    Top with croutons and shaved parmesan. Serve immediately.

Tools you’ll need

  • cutting board
  • sharp knife
  • large mixing bowl
  • whisk
  • vegetable spinner or paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is an iPhone and Android app that finds real recipes from the ingredients you already have. No more grocery-list aspirations. Try it free for 7 days.