Custrd is out on the App Store — Download it free →
Back to recipes

Korean Spicy Fried Chicken

Crispy fried chicken pieces tossed in a sweet, spicy, glossy sauce. Ready in about 20 minutes, this is a quick and satisfying weeknight dinner or snack.

Total time
25 min
Servings
4
Calories
520
Protein
25g
Korean Spicy Fried Chicken
comfort foodindulgentKoreandairy-freechickencrispystickyweeknight dinner

Ingredients

6 items — tap to check off

Missing one? Custrd suggests a swap that works.

Open the app

Instructions

  1. Step 1

    Pat the 1.5 lb chicken dry with paper towels, then toss with the 1/2 cup cornstarch until evenly coated.

  2. Step 2

    Heat the 2 cups vegetable oil in a deep pot over medium-high until a pinch of cornstarch sizzles immediately, about 350°F.

  3. Step 3

    Fry the chicken in batches without crowding, turning occasionally, until golden brown and cooked through, about 8-10 minutes per batch. Drain on paper towels.

  4. Step 4

    In a large bowl, whisk together the 2 tbsp gochujang, 2 tbsp honey, and 1 tbsp soy sauce. Add the hot fried chicken and toss to coat evenly.

  5. Step 5

    Serve immediately, sprinkled with sesame seeds or sliced green onions if you like.

Tools you’ll need

  • Deep pot or Dutch oven
  • Tongs
  • Large bowl
  • Paper towels

Cook smarter

Get matched recipes for what’s in your fridge

Custrd is a free iOS app that finds real recipes from the ingredients you already have. No more grocery-list aspirations.